Lineage for d1n6ei3 (1n6e I:320-679)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1135268Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1135611Superfamily b.69.9: Tricorn protease domain 2 [69322] (1 family) (S)
    distorted 7-bladed beta-propeller fold; possibly related to the N-terminal domain of tricorn protease (a 6-bladed beta-propeller)
  5. 1135612Family b.69.9.1: Tricorn protease domain 2 [69323] (1 protein)
  6. 1135613Protein Tricorn protease domain 2 [69324] (1 species)
  7. 1135614Species Thermoplasma acidophilum [TaxId:2303] [69325] (4 PDB entries)
  8. 1135625Domain d1n6ei3: 1n6e I:320-679 [80167]
    Other proteins in same PDB: d1n6ea1, d1n6ea2, d1n6ea4, d1n6ec1, d1n6ec2, d1n6ec4, d1n6ee1, d1n6ee2, d1n6ee4, d1n6eg1, d1n6eg2, d1n6eg4, d1n6ei1, d1n6ei2, d1n6ei4, d1n6ek1, d1n6ek2, d1n6ek4
    complexed with chm

Details for d1n6ei3

PDB Entry: 1n6e (more details), 2.6 Å

PDB Description: tricorn protease in complex with a tridecapeptide chloromethyl ketone derivative
PDB Compounds: (I:) tricorn protease

SCOPe Domain Sequences for d1n6ei3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ei3 b.69.9.1 (I:320-679) Tricorn protease domain 2 {Thermoplasma acidophilum [TaxId: 2303]}
sipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafih
gtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkpt
viersreamitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattensh
dyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsm
tseageydlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvl
lkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplv

SCOPe Domain Coordinates for d1n6ei3:

Click to download the PDB-style file with coordinates for d1n6ei3.
(The format of our PDB-style files is described here.)

Timeline for d1n6ei3: