Class b: All beta proteins [48724] (174 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller) |
Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein) |
Protein Tricorn protease N-terminal domain [69306] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries) |
Domain d1n6ei2: 1n6e I:39-319 [80166] Other proteins in same PDB: d1n6ea1, d1n6ea3, d1n6ea4, d1n6ec1, d1n6ec3, d1n6ec4, d1n6ee1, d1n6ee3, d1n6ee4, d1n6eg1, d1n6eg3, d1n6eg4, d1n6ei1, d1n6ei3, d1n6ei4, d1n6ek1, d1n6ek3, d1n6ek4 complexed with chm |
PDB Entry: 1n6e (more details), 2.6 Å
SCOPe Domain Sequences for d1n6ei2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6ei2 b.68.7.1 (I:39-319) Tricorn protease N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl ntdgrrilfskggsiyifnpdtekiekieigdlespedrii
Timeline for d1n6ei2: