SCOPe 2.06: Domain d1n69b1: 1n69 B:1-78

Lineage for d1n69b1 (1n69 B:1-78)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (5 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.3: Saposin B [81806] (2 proteins)
   the alternative subunit conformation is an open four-helical bundle; helices 3 and 4 form a contiguous helix

6. Protein Saposin B [81807] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81808] (1 PDB entry)

8. Domain d1n69b1: 1n69 B:1-78 [80119]
   Other proteins in same PDB: d1n69b2
   the alternative subunit conformation
   complexed with peh

Details for d1n69b1

PDB Entry: 1n69, 2.2 Å

PDB Description: crystal structure of human saposin b

PDB Compounds: (B:) saposin b

SCOPe Domain Sequences for d1n69b1:

Sequence; same for both SEQRES and ATOM records:

>d1n69b1 a.64.1.3 (B:1-78) Saposin B {Human (Homo sapiens) [TaxId: 9606]}
gdvcqdciqmvtdiqtavrtnstfvqalvehvkeecdrlgpgmadicknyisqyseiaiq
mmmhmqpkeicalvgfcd

Timeline for d1n69b1:

• d1n69b1 first appeared in SCOP 1.63, called d1n69b_
  
• d1n69b1 was called d1n69b_ in SCOPe 2.05
  
• d1n69b1 appears in SCOPe 2.07
  
• d1n69b1 appears in the current release, SCOPe 2.08