SCOP 1.71: Domain d1n5yh2: 1n5y H:124-225

Lineage for d1n5yh2 (1n5y H:124-225)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1n5yh2: 1n5y H:124-225 [80061]
   Other proteins in same PDB: d1n5ya1, d1n5ya2, d1n5yb_, d1n5yh1, d1n5yl1, d1n5yl2
   part of Fab 28 against HIV-1 RT
   complexed with atm, mg, mrg; mutant

Details for d1n5yh2

PDB Entry: 1n5y, 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to post-translocation aztmp- terminated dna (complex p)

SCOP Domain Sequences for d1n5yh2:

Sequence; same for both SEQRES and ATOM records:

>d1n5yh2 b.1.1.2 (H:124-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpadc

Timeline for d1n5yh2:

• d1n5yh2 first appeared in SCOP 1.63
  
• d1n5yh2 appears in SCOP 1.69
  
• d1n5yh2 appears in SCOP 1.73
  
• d1n5yh2 appears in the current release, SCOPe 2.08