Lineage for d1n5yh2 (1n5y H:124-225)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453749Domain d1n5yh2: 1n5y H:124-225 [80061]
    Other proteins in same PDB: d1n5ya1, d1n5ya2, d1n5yb_, d1n5yh1, d1n5yl1, d1n5yl2
    part of Fab 28 against HIV-1 RT

Details for d1n5yh2

PDB Entry: 1n5y (more details), 3.1 Å

PDB Description: HIV-1 Reverse Transcriptase Crosslinked to Post-Translocation AZTMP-Terminated DNA (Complex P)

SCOP Domain Sequences for d1n5yh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5yh2 b.1.1.2 (H:124-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpadc

SCOP Domain Coordinates for d1n5yh2:

Click to download the PDB-style file with coordinates for d1n5yh2.
(The format of our PDB-style files is described here.)

Timeline for d1n5yh2: