Lineage for d1n5yl2 (1n5y L:108-211)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 550187Domain d1n5yl2: 1n5y L:108-211 [80063]
    Other proteins in same PDB: d1n5ya1, d1n5ya2, d1n5yb_, d1n5yh1, d1n5yh2, d1n5yl1
    part of Fab 28 against HIV-1 RT
    complexed with atm, mg, mrg; mutant

Details for d1n5yl2

PDB Entry: 1n5y (more details), 3.1 Å

PDB Description: HIV-1 Reverse Transcriptase Crosslinked to Post-Translocation AZTMP-Terminated DNA (Complex P)
PDB Compounds: (L:)

SCOP Domain Sequences for d1n5yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5yl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1n5yl2:

Click to download the PDB-style file with coordinates for d1n5yl2.
(The format of our PDB-style files is described here.)

Timeline for d1n5yl2: