Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries) Uniprot P80372 |
Domain d1n33c1: 1n33 C:2-106 [79892] Other proteins in same PDB: d1n33b_, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_ complexed with mg, par, psu, zn |
PDB Entry: 1n33 (more details), 3.35 Å
SCOP Domain Sequences for d1n33c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n33c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1n33c1: