![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein S11 [53141] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries) Uniprot P80376 |
![]() | Domain d1n33k_: 1n33 K: [79902] Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_ complexed with mg, par, psu, zn |
PDB Entry: 1n33 (more details), 3.35 Å
SCOP Domain Sequences for d1n33k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n33k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
Timeline for d1n33k_: