Lineage for d1n33f_ (1n33 F:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862903Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 862904Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 862905Protein Ribosomal protein S6 [54997] (4 species)
  7. 862935Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 862966Domain d1n33f_: 1n33 F: [79897]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, psu, zn

Details for d1n33f_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
PDB Compounds: (F:) 30S ribosomal protein S6

SCOP Domain Sequences for d1n33f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1n33f_:

Click to download the PDB-style file with coordinates for d1n33f_.
(The format of our PDB-style files is described here.)

Timeline for d1n33f_: