SCOP 1.69: Domain d1n26a3: 1n26 A:196-299

Lineage for d1n26a3 (1n26 A:196-299)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (24 proteins)

6. Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81978] (2 PDB entries)

8. Domain d1n26a3: 1n26 A:196-299 [79852]
   Other proteins in same PDB: d1n26a1

Details for d1n26a3

PDB Entry: 1n26, 2.4 Å

PDB Description: crystal structure of the extra-cellular domains of human interleukin-6 receptor alpha chain

SCOP Domain Sequences for d1n26a3:

Sequence; same for both SEQRES and ATOM records:

>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens)}
qpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvkdlq
hhcvihdawsglrhvvqlraqeefgqgewsewspeamgtpwtes

Timeline for d1n26a3:

• d1n26a3 first appeared in SCOP 1.63
  
• d1n26a3 appears in SCOP 1.67
  
• d1n26a3 appears in SCOP 1.71
  
• d1n26a3 appears in the current release, SCOPe 2.08