Lineage for d1n26a3 (1n26 A:196-299)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762034Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)
  7. 2762035Species Human (Homo sapiens) [TaxId:9606] [81978] (3 PDB entries)
  8. 2762037Domain d1n26a3: 1n26 A:196-299 [79852]
    Other proteins in same PDB: d1n26a1
    complexed with cys, nag, so4

Details for d1n26a3

PDB Entry: 1n26 (more details), 2.4 Å

PDB Description: crystal structure of the extra-cellular domains of human interleukin-6 receptor alpha chain
PDB Compounds: (A:) IL-6 Receptor alpha chain

SCOPe Domain Sequences for d1n26a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
qpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvkdlq
hhcvihdawsglrhvvqlraqeefgqgewsewspeamgtpwtes

SCOPe Domain Coordinates for d1n26a3:

Click to download the PDB-style file with coordinates for d1n26a3.
(The format of our PDB-style files is described here.)

Timeline for d1n26a3: