SCOPe 2.04: Domain d1n1jb_: 1n1j B:

Lineage for d1n1jb_ (1n1j B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)

6. Protein Nuclear transcription factor Y subunit gamma (Nf-Yc2) [81726] (1 species)
   forms a heterodimer with Nf-Yb3 similar to H2A/H2B

7. Species Human (Homo sapiens) [TaxId:9606] [81727] (1 PDB entry)

8. Domain d1n1jb_: 1n1j B: [79814]
   Other proteins in same PDB: d1n1ja_

Details for d1n1jb_

PDB Entry: 1n1j, 1.67 Å

PDB Description: crystal structure of the nf-yb/nf-yc histone pair

PDB Compounds: (B:) nf-yc

SCOPe Domain Sequences for d1n1jb_:

Sequence; same for both SEQRES and ATOM records:

>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]}
lplarikkimkldedvkmisaeapvlfakaaqifiteltlrawihtednkrrtlqrndia
maitkfdqfdflidivpr

Timeline for d1n1jb_:

• d1n1jb_ first appeared in SCOP 1.63
  
• d1n1jb_ appears in SCOPe 2.03
  
• d1n1jb_ appears in SCOPe 2.05
  
• d1n1jb_ appears in the current release, SCOPe 2.08