Lineage for d1n0ha3 (1n0h A:461-687)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986456Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 986457Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 986732Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 986733Protein Acetohydroxyacid synthase catalytic subunit [88758] (2 species)
  7. 986734Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (6 PDB entries)
    Uniprot P07342 84-687
  8. 986747Domain d1n0ha3: 1n0h A:461-687 [79736]
    Other proteins in same PDB: d1n0ha1, d1n0ha2, d1n0hb1, d1n0hb2
    complexed with ayd, cie, dtt, fad, k, mg, tpp

Details for d1n0ha3

PDB Entry: 1n0h (more details), 2.8 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl
PDB Compounds: (A:) Acetolactate synthase

SCOPe Domain Sequences for d1n0ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0ha3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh

SCOPe Domain Coordinates for d1n0ha3:

Click to download the PDB-style file with coordinates for d1n0ha3.
(The format of our PDB-style files is described here.)

Timeline for d1n0ha3: