![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) ![]() both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules |
![]() | Family c.36.1.1: Pyruvate oxidase and decarboxylase THDP-binding domains [52519] (4 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Acetohydroxyacid synthase catalytic subunit [69470] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69471] (2 PDB entries) |
![]() | Domain d1n0ha3: 1n0h A:461-687 [79736] Other proteins in same PDB: d1n0ha1, d1n0hb1 |
PDB Entry: 1n0h (more details), 2.8 Å
SCOP Domain Sequences for d1n0ha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0ha3 c.36.1.1 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)} aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl levevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh
Timeline for d1n0ha3: