SCOP 1.63: Domain d1mzja1: 1mzj A:3-183

Lineage for d1mzja1 (1mzj A:3-183)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudodyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (6 proteins)

6. Protein Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway [82561] (1 species)

7. Species Streptomyces sp. r1128 [TaxId:140437] [82562] (1 PDB entry)

8. Domain d1mzja1: 1mzj A:3-183 [79700]

Details for d1mzja1

PDB Entry: 1mzj, 2.1 Å

PDB Description: Crystal Structure of the Priming beta-Ketosynthase from the R1128 Polyketide Biosynthetic Pathway

SCOP Domain Sequences for d1mzja1:

Sequence; same for both SEQRES and ATOM records:

>d1mzja1 c.95.1.1 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128}
glrvperrfsrvlgvgsyrprrevsnkevctwidsteewietrtgirsrriaepdetiqv
mgvaasrralehagvdpaeidlvvvstmtnfvhtpplsvaiahelgadnaggfdlsaaca
gfchalsiaadavesggsrhvlvvatermtdvidladrslsflfgdgagaavvgpsdvpg
i

Timeline for d1mzja1:

• d1mzja1 is new in SCOP 1.63
  
• d1mzja1 appears in SCOP 1.65
  
• d1mzja1 appears in the current release, SCOPe 2.08