Lineage for d1mzjb2 (1mzj B:184-335)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 251049Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudodyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest
  4. 251050Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 251051Family c.95.1.1: Thiolase-related [53902] (6 proteins)
  6. 251222Protein Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway [82561] (1 species)
  7. 251223Species Streptomyces sp. r1128 [TaxId:140437] [82562] (1 PDB entry)
  8. 251227Domain d1mzjb2: 1mzj B:184-335 [79703]
    complexed with ace, coa

Details for d1mzjb2

PDB Entry: 1mzj (more details), 2.1 Å

PDB Description: Crystal Structure of the Priming beta-Ketosynthase from the R1128 Polyketide Biosynthetic Pathway

SCOP Domain Sequences for d1mzjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzjb2 c.95.1.1 (B:184-335) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128}
gpvvrgidgtglgslhmssswdqyvedpsvgrpalvmdgkrvfrwavadvvpaarealev
agltvgdlvafvphqanlriidvlvdrlgvpehvvvsrdaedtgntssasvalaldrlvr
sgavpgggpalmigfgaglsyagqalllpdpp

SCOP Domain Coordinates for d1mzjb2:

Click to download the PDB-style file with coordinates for d1mzjb2.
(The format of our PDB-style files is described here.)

Timeline for d1mzjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mzjb1