![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [82271] (1 PDB entry) |
![]() | Domain d1mzha_: 1mzh A: [79698] structural genomics; QR15 CASP5 complexed with po4 |
PDB Entry: 1mzh (more details), 2 Å
SCOPe Domain Sequences for d1mzha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} midvrkyidnaalkphlsekeieefvlkseelgiyavcvnpyhvklassiakkvkvccvi gfplglnktsvkvkeaveavrdgaqeldivwnlsafksekydfvveelkeifretpsavh kvivetpylneeeikkaveicieagadfiktstgfaprgttleevrlikssakgrikvka sggirdletaismieagadrigtssgisiaeeflkrhlilehhhh
Timeline for d1mzha_: