Lineage for d1mzha_ (1mzh A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1821769Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)
  7. 1821773Species Aquifex aeolicus [TaxId:63363] [82271] (1 PDB entry)
  8. 1821774Domain d1mzha_: 1mzh A: [79698]
    structural genomics; QR15
    CASP5
    complexed with po4

Details for d1mzha_

PDB Entry: 1mzh (more details), 2 Å

PDB Description: QR15, an Aldolase
PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d1mzha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]}
midvrkyidnaalkphlsekeieefvlkseelgiyavcvnpyhvklassiakkvkvccvi
gfplglnktsvkvkeaveavrdgaqeldivwnlsafksekydfvveelkeifretpsavh
kvivetpylneeeikkaveicieagadfiktstgfaprgttleevrlikssakgrikvka
sggirdletaismieagadrigtssgisiaeeflkrhlilehhhh

SCOPe Domain Coordinates for d1mzha_:

Click to download the PDB-style file with coordinates for d1mzha_.
(The format of our PDB-style files is described here.)

Timeline for d1mzha_: