Lineage for d1mx3a1 (1mx3 A:126-318)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844156Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2844306Protein Transcription corepressor CtbP [82298] (2 species)
    C-terminal binding protein 1; a dehydrogenase
  7. 2844307Species Human (Homo sapiens), Ctbp1 [TaxId:9606] [82299] (4 PDB entries)
  8. 2844308Domain d1mx3a1: 1mx3 A:126-318 [79638]
    Other proteins in same PDB: d1mx3a2, d1mx3a3
    complexed with acy, nad

Details for d1mx3a1

PDB Entry: 1mx3 (more details), 1.95 Å

PDB Description: Crystal structure of CtBP dehydrogenase core holo form
PDB Compounds: (A:) C-terminal binding protein 1

SCOPe Domain Sequences for d1mx3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]}
eetadstlchilnlyrratwlhqalregtrvqsveqirevasgaarirgetlgiiglgrv
gqavalrakafgfnvlfydpylsdgveralglqrvstlqdllfhsdcvtlhcglnehnhh
lindftvkqmrqgaflvntargglvdekalaqalkegrirgaaldvhesepfsfsqgplk
dapnlictphaaw

SCOPe Domain Coordinates for d1mx3a1:

Click to download the PDB-style file with coordinates for d1mx3a1.
(The format of our PDB-style files is described here.)

Timeline for d1mx3a1: