SCOP 1.63: Domain d1mx2b_: 1mx2 B:

Lineage for d1mx2b_ (1mx2 B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (1 family)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (12 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein p18ink4C(ink6) [48412] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48413] (6 PDB entries)

8. Domain d1mx2b_: 1mx2 B: [79637]
   mutant

Details for d1mx2b_

PDB Entry: 1mx2, 2.25 Å

PDB Description: structure of f71n mutant of p18ink4c

SCOP Domain Sequences for d1mx2b_:

Sequence; same for both SEQRES and ATOM records:

>d1mx2b_ d.211.1.1 (B:) p18ink4C(ink6) {Human (Homo sapiens)}
nelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdlk
drtgnavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkht
asnvghrnhkgdtacdlarlygrnevvslmqangag

Timeline for d1mx2b_:

• d1mx2b_ is new in SCOP 1.63
  
• d1mx2b_ appears in SCOP 1.65
  
• d1mx2b_ appears in the current release, SCOPe 2.08