Lineage for d1mm6a_ (1mm6 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1185560Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 1185569Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (104 PDB entries)
  8. 1185747Domain d1mm6a_: 1mm6 A: [79296]
    complexed with gol, qus, so4

Details for d1mm6a_

PDB Entry: 1mm6 (more details), 2.15 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with quisqualate in a non zinc crystal form at 2.15 angstroms resolution
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d1mm6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mm6a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
anktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgky
gardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpi
esaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarv
rkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkl
neqglldklknkwwydkgecg

SCOPe Domain Coordinates for d1mm6a_:

Click to download the PDB-style file with coordinates for d1mm6a_.
(The format of our PDB-style files is described here.)

Timeline for d1mm6a_: