SCOPe 2.03: Domain d1mm5a_: 1mm5 A:

Lineage for d1mm5a_ (1mm5 A:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.2: Outer membrane enzyme PagP [82874] (2 proteins)
   automatically mapped to Pfam PF07017

6. Protein Outer membrane enzyme PagP [82875] (1 species)

7. Species Escherichia coli [TaxId:562] [82876] (3 PDB entries)
   Uniprot Q7C2L2

8. Domain d1mm5a_: 1mm5 A: [79295]

Details for d1mm5a_

PDB Entry: 1mm5

PDB Description: solution nmr structure of the outer membrane enzyme pagp in og micelles

PDB Compounds: (A:) CrcA protein

SCOPe Domain Sequences for d1mm5a_:

Sequence; same for both SEQRES and ATOM records:

>d1mm5a_ f.4.1.2 (A:) Outer membrane enzyme PagP {Escherichia coli [TaxId: 562]}
mnadewmttfreniaqtwqqpehydlyipaitwharfaydkektdrynerpwgggfglsr
wdekgnwhglyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwny
iplpvllplasvgygpvtfqmtyipgtynngnvyfawmrfqflehhhhhh

Timeline for d1mm5a_:

• d1mm5a_ first appeared in SCOP 1.63
  
• d1mm5a_ appears in SCOPe 2.02
  
• d1mm5a_ appears in SCOPe 2.04
  
• d1mm5a_ appears in the current release, SCOPe 2.08, called d1mm5a1