Lineage for d1mm5a1 (1mm5 A:2-162)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575769Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2575791Family f.4.1.2: Outer membrane enzyme PagP [82874] (2 proteins)
    automatically mapped to Pfam PF07017
  6. 2575792Protein Outer membrane enzyme PagP [82875] (1 species)
  7. 2575793Species Escherichia coli [TaxId:562] [82876] (3 PDB entries)
    Uniprot Q7C2L2
  8. 2575796Domain d1mm5a1: 1mm5 A:2-162 [79295]
    Other proteins in same PDB: d1mm5a2, d1mm5a3

Details for d1mm5a1

PDB Entry: 1mm5 (more details)

PDB Description: Solution NMR structure of the outer membrane enzyme PagP in OG micelles
PDB Compounds: (A:) CrcA protein

SCOPe Domain Sequences for d1mm5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mm5a1 f.4.1.2 (A:2-162) Outer membrane enzyme PagP {Escherichia coli [TaxId: 562]}
nadewmttfreniaqtwqqpehydlyipaitwharfaydkektdrynerpwgggfglsrw
dekgnwhglyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwnyi
plpvllplasvgygpvtfqmtyipgtynngnvyfawmrfqf

SCOPe Domain Coordinates for d1mm5a1:

Click to download the PDB-style file with coordinates for d1mm5a1.
(The format of our PDB-style files is described here.)

Timeline for d1mm5a1: