Lineage for d1mm5a_ (1mm5 A:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267556Fold f.4: Transmembrane beta-barrels [56924] (4 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 267557Superfamily f.4.1: OMPA-like [56925] (2 families) (S)
    forms (8,10) barrel
  5. 267568Family f.4.1.2: Outer membrane enzyme PagP [82874] (1 protein)
  6. 267569Protein Outer membrane enzyme PagP [82875] (1 species)
  7. 267570Species Escherichia coli [TaxId:562] [82876] (2 PDB entries)
  8. 267572Domain d1mm5a_: 1mm5 A: [79295]
    mutant

Details for d1mm5a_

PDB Entry: 1mm5 (more details)

PDB Description: Solution NMR structure of the outer membrane enzyme PagP in OG micelles

SCOP Domain Sequences for d1mm5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mm5a_ f.4.1.2 (A:) Outer membrane enzyme PagP {Escherichia coli}
mnadewmttfreniaqtwqqpehydlyipaitwharfaydkektdrynerpwgggfglsr
wdekgnwhglyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwny
iplpvllplasvgygpvtfqmtyipgtynngnvyfawmrfqflehhhhhh

SCOP Domain Coordinates for d1mm5a_:

Click to download the PDB-style file with coordinates for d1mm5a_.
(The format of our PDB-style files is described here.)

Timeline for d1mm5a_: