Lineage for d1ml5u_ (1ml5 U:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 345888Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 345889Protein 70S ribosome functional complex [58121] (2 species)
  7. 345890Species Escherichia coli [TaxId:562] [58123] (21 PDB entries)
  8. 346051Domain d1ml5u_: 1ml5 U: [79276]

Details for d1ml5u_

PDB Entry: 1ml5 (more details)

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2

SCOP Domain Sequences for d1ml5u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml5u_ i.1.1.1 (U:) 70S ribosome functional complex {Escherichia coli}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1ml5u_:

Click to download the PDB-style file with coordinates for d1ml5u_.
(The format of our PDB-style files is described here.)

Timeline for d1ml5u_: