SCOP 1.65: Domain d1ml5h_: 1ml5 H:

Lineage for d1ml5h_ (1ml5 H:)

1. Root: SCOP 1.65

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Escherichia coli [TaxId:562] [58123] (21 PDB entries)

8. Domain d1ml5h_: 1ml5 H: [79263]

Details for d1ml5h_

PDB Entry: 1ml5

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2

SCOP Domain Sequences for d1ml5h_:

Sequence; same for both SEQRES and ATOM records:

>d1ml5h_ i.1.1.1 (H:) 70S ribosome functional complex {Escherichia coli}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

Timeline for d1ml5h_:

• d1ml5h_ first appeared in SCOP 1.63
  
• d1ml5h_ appears in SCOP 1.67
  
• d1ml5h_ appears in the current release, SCOPe 2.08