SCOP 1.63: Domain d1ml5u_: 1ml5 U:

Lineage for d1ml5u_ (1ml5 U:)

1. Root: SCOP 1.63

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Escherichia coli [TaxId:562] [58123] (10 PDB entries)

8. Domain d1ml5u_: 1ml5 U: [79276]

Details for d1ml5u_

PDB Entry: 1ml5

PDB Description: structure of the e. coli ribosomal termination complex with release factor 2

SCOP Domain Sequences for d1ml5u_:

Sequence; same for both SEQRES and ATOM records:

>d1ml5u_ i.1.1.1 (U:) 70S ribosome functional complex {Escherichia coli}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1ml5u_:

• d1ml5u_ is new in SCOP 1.63
  
• d1ml5u_ appears in SCOP 1.65
  
• d1ml5u_ appears in the current release, SCOPe 2.08