| Class i: Low resolution protein structures [58117] (18 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (2 species) |
| Species Escherichia coli [TaxId:562] [58123] (10 PDB entries) |
| Domain d1ml5u_: 1ml5 U: [79276] |
PDB Entry: 1ml5 (more details)
SCOP Domain Sequences for d1ml5u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ml5u_ i.1.1.1 (U:) 70S ribosome functional complex {Escherichia coli}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk
Timeline for d1ml5u_: