| Class i: Low resolution protein structures [58117] (24 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (3 species) |
| Species Escherichia coli [TaxId:562] [58123] (39 PDB entries) |
| Domain d1mj1l_: 1mj1 L: [79178] Fitting the ternary complex of EF-TU/tRNA/GTP in the cryo-EM map |
PDB Entry: 1mj1 (more details)
SCOP Domain Sequences for d1mj1l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mj1l_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv
Timeline for d1mj1l_: