PDB entry 1mj1

View 1mj1 on RCSB PDB site
Description: fitting the ternary complex of ef-tu/trna/gtp and ribosomal proteins into a 13 a cryo-em map of the coli 70s ribosome
Deposited on 2002-08-26, released 2002-11-01
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1mj1a_
  • Chain 'C':
    Domains in SCOP 1.71: d1mj1c_
  • Chain 'D':
    Domains in SCOP 1.71: d1mj1d_
  • Chain 'L':
    Domains in SCOP 1.71: d1mj1l_
  • Chain 'O':
    Domains in SCOP 1.71: d1mj1o_
  • Chain 'P':
    Domains in SCOP 1.71: d1mj1p_
  • Chain 'Q':
    Domains in SCOP 1.71: d1mj1q_
  • Chain 'R':
    Domains in SCOP 1.71: d1mj1r_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mj1A (A:)
    akgefirtkrhvnvgtighvdhgkttltaaltyvaaaenrnvevkdygdidkareerarg
    itintahveyetakrhyshvdcrghadyiknmitgaaqmdgailvvsaadgrmrqtrehi
    llarqvgvryivvfmnkvdmvddrelldlvemevrdllnqyefrgdevrvirgsallale
    emhknrktkrgenewvdkiwelldaideyirtrvrdvdkrflmrvedvftitgrgtvatg
    riergkvkvgdeveivglaretrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakrgsitrhtkfeasvyilkkeeggrhtgfftgyrrqfyfrttdvtgvvrlrqgve
    mvmrgdnvtftvelikrvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mj1L (L:)
    makkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitv
    yedksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnans
    leaamkiiegtaksmgievvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj1L (L:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1mj1O (O:)
    mvalptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrl
    tsgyevtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrsky
    gtkkpkeaaktaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj1O (O:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1mj1P (P:)
    mariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyv
    entwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagk
    kkaprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mj1P (P:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.