SCOP 1.63: Domain d1mj1l_: 1mj1 L:

Lineage for d1mj1l_ (1mj1 L:)

1. Root: SCOP 1.63

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Escherichia coli [TaxId:562] [58123] (10 PDB entries)

8. Domain d1mj1l_: 1mj1 L: [79178]
   Fitting the ternary complex of EF-TU/tRNA/GTP in the cryo-EM map

Details for d1mj1l_

PDB Entry: 1mj1

PDB Description: fitting the ternary complex of ef-tu/trna/gtp and ribosomal proteins into a 13 a cryo-em map of the coli 70s ribosome

SCOP Domain Sequences for d1mj1l_:

Sequence; same for both SEQRES and ATOM records:

>d1mj1l_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

Timeline for d1mj1l_:

• d1mj1l_ is new in SCOP 1.63
  
• d1mj1l_ appears in SCOP 1.65
  
• d1mj1l_ appears in the current release, SCOPe 2.08