Lineage for d1miua5 (1miu A:2971-3103)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799474Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 799502Protein OB-fold domains of BRCA2 [82099] (2 species)
    duplication: tandem repeat of three OB-fold domains
  7. 799503Species Mouse (Mus musculus) [TaxId:10090] [82100] (2 PDB entries)
  8. 799506Domain d1miua5: 1miu A:2971-3103 [79157]
    Other proteins in same PDB: d1miua1, d1miua2
    complexed with hg

Details for d1miua5

PDB Entry: 1miu (more details), 3.1 Å

PDB Description: Structure of a BRCA2-DSS1 complex
PDB Compounds: (A:) Breast Cancer type 2 susceptibility protein

SCOP Domain Sequences for d1miua5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1miua5 b.40.4.3 (A:2971-3103) OB-fold domains of BRCA2 {Mouse (Mus musculus) [TaxId: 10090]}
reslhfsrlsdpafqppcsevdvvgvvvsvvkpiglaplvylsdeclnllvvkfgidlne
dikprvliaasnlqcqpestsgvptlfaghfsifsaspkeayfqekvnnlkhaienidtf
ykeaekklihvle

SCOP Domain Coordinates for d1miua5:

Click to download the PDB-style file with coordinates for d1miua5.
(The format of our PDB-style files is described here.)

Timeline for d1miua5: