Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins) barrel, closed; n=5, S=10 |
Protein OB-fold domains of BRCA2 [82099] (2 species) duplication: tandem repeat of three OB-fold domains |
Species Mouse (Mus musculus) [TaxId:10090] [82100] (2 PDB entries) |
Domain d1miua5: 1miu A:2971-3103 [79157] Other proteins in same PDB: d1miua1, d1miua2 complexed with hg |
PDB Entry: 1miu (more details), 3.1 Å
SCOP Domain Sequences for d1miua5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1miua5 b.40.4.3 (A:2971-3103) OB-fold domains of BRCA2 {Mouse (Mus musculus) [TaxId: 10090]} reslhfsrlsdpafqppcsevdvvgvvvsvvkpiglaplvylsdeclnllvvkfgidlne dikprvliaasnlqcqpestsgvptlfaghfsifsaspkeayfqekvnnlkhaienidtf ykeaekklihvle
Timeline for d1miua5:
View in 3D Domains from same chain: (mouse over for more information) d1miua1, d1miua2, d1miua3, d1miua4 |