SCOP 1.75: Domain d1miua1: 1miu A:2399-2589

Lineage for d1miua1 (1miu A:2399-2589)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.170: BRCA2 helical domain [81871] (1 superfamily)
   multihelical; contains a 3-helical bundle surrounded by several shorter helices

4. Superfamily a.170.1: BRCA2 helical domain [81872] (1 family)

5. Family a.170.1.1: BRCA2 helical domain [81873] (1 protein)

6. Protein BRCA2 helical domain [81874] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [81875] (2 PDB entries)

8. Domain d1miua1: 1miu A:2399-2589 [79153]
   Other proteins in same PDB: d1miua2, d1miua3, d1miua4, d1miua5
   complexed with human Dss1 fragment, chain B
   complexed with hg

Details for d1miua1

PDB Entry: 1miu, 3.1 Å

PDB Description: Structure of a BRCA2-DSS1 complex

PDB Compounds: (A:) Breast Cancer type 2 susceptibility protein

SCOP Domain Sequences for d1miua1:

Sequence; same for both SEQRES and ATOM records:

>d1miua1 a.170.1.1 (A:2399-2589) BRCA2 helical domain {Mouse (Mus musculus) [TaxId: 10090]}
kdlmsslqsardlqdmriknkerrhlrlqpgslyltksstlprislqaavgdrapsacsp
kqlyiygvskecinvnsknaeyfqfdiqdhfgkedlcagkgfqladggwlipsndgkagk
eefyralcdtpgvdpklissiwvanhyrwivwklaamefafpkefanrclnpervllqlk
yrydveidnsr

Timeline for d1miua1:

• d1miua1 first appeared in SCOP 1.63
  
• d1miua1 appears in SCOP 1.73
  
• d1miua1 appears in SCOPe 2.01
  
• d1miua1 appears in the current release, SCOPe 2.08