Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Anti-HCV Fab 19D9D6, (mouse), kappa L chain [81947] (3 PDB entries) |
Domain d1mhhb1: 1mhh B:1-113 [79121] Other proteins in same PDB: d1mhha2, d1mhhb2, d1mhhc2, d1mhhd2, d1mhhe_, d1mhhf_ |
PDB Entry: 1mhh (more details), 2.1 Å
SCOP Domain Sequences for d1mhhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhhb1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-HCV Fab 19D9D6, (mouse), kappa L chain} qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvss
Timeline for d1mhhb1: