Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (16 families) contains an insert alpha+beta subdomain; similar overall fold to the Cof family usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (1 protein) the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP |
Protein 5'(3')-deoxyribonucleotidase (dNT-2) [82383] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82384] (3 PDB entries) |
Domain d1mh9a_: 1mh9 A: [79118] |
PDB Entry: 1mh9 (more details), 1.8 Å
SCOP Domain Sequences for d1mh9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mh9a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens)} ralrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs waddwkaildskrp
Timeline for d1mh9a_: