Lineage for d1mh4a2 (1mh4 A:1-366)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1185424Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 1185433Species Escherichia coli [TaxId:562] [53863] (47 PDB entries)
    Uniprot P02928
  8. 1185482Domain d1mh4a2: 1mh4 A:1-366 [79115]
    Other proteins in same PDB: d1mh4a1
    chimera with yeast a1 homeodomain

Details for d1mh4a2

PDB Entry: 1mh4 (more details), 2.3 Å

PDB Description: maltose binding-a1 homeodomain protein chimera, crystal form ii
PDB Compounds: (A:) maltose binding-a1 homeodomain protein chimera

SCOPe Domain Sequences for d1mh4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh4a2 c.94.1.1 (A:1-366) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqt

SCOPe Domain Coordinates for d1mh4a2:

Click to download the PDB-style file with coordinates for d1mh4a2.
(The format of our PDB-style files is described here.)

Timeline for d1mh4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mh4a1