Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [82121] (1 PDB entry) |
Domain d1mbqa_: 1mbq A: [78920] complexed with ben, ca |
PDB Entry: 1mbq (more details), 1.8 Å
SCOPe Domain Sequences for d1mbqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbqa_ b.47.1.2 (A:) Trypsin(ogen) {Chum salmon (Oncorhynchus keta) [TaxId: 8018]} ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg seqfisssrvirhpnyssynidndimliklsksatlntyvqpvalpsscapagtmctvsg wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv vcngelqgvvswgygcaepgnpgvyakvcifndwltstma
Timeline for d1mbqa_: