Lineage for d1mbqa_ (1mbq A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794264Protein Trypsin(ogen) [50515] (9 species)
  7. 1794280Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [82121] (1 PDB entry)
  8. 1794281Domain d1mbqa_: 1mbq A: [78920]
    complexed with ben, ca

Details for d1mbqa_

PDB Entry: 1mbq (more details), 1.8 Å

PDB Description: Anionic Trypsin from Pacific Chum Salmon
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1mbqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbqa_ b.47.1.2 (A:) Trypsin(ogen) {Chum salmon (Oncorhynchus keta) [TaxId: 8018]}
ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklsksatlntyvqpvalpsscapagtmctvsg
wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstma

SCOPe Domain Coordinates for d1mbqa_:

Click to download the PDB-style file with coordinates for d1mbqa_.
(The format of our PDB-style files is described here.)

Timeline for d1mbqa_: