Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N |
Superfamily c.10.2: L domain-like [52058] (7 families) less regular structure consisting of variable repeats |
Family c.10.2.1: Internalin LRR domain [52059] (3 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
Protein Internalin B [52060] (1 species) |
Species Listeria monocytogenes [TaxId:1639] [52061] (3 PDB entries) |
Domain d1m9sa5: 1m9s A:36-240 [78878] Other proteins in same PDB: d1m9sa1, d1m9sa2, d1m9sa3, d1m9sa4 complexed with so4, tb |
PDB Entry: 1m9s (more details), 2.65 Å
SCOP Domain Sequences for d1m9sa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m9sa5 c.10.2.1 (A:36-240) Internalin B {Listeria monocytogenes} etitvstpikqifpddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq ylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehngis dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl sknhisdlralaglknldvlelfsq
Timeline for d1m9sa5:
View in 3D Domains from same chain: (mouse over for more information) d1m9sa1, d1m9sa2, d1m9sa3, d1m9sa4 |