Lineage for d1m9sa1 (1m9s A:241-319)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223603Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
    truncated fold fused to an LRR domain
  6. 223610Protein Internalin B [69172] (1 species)
  7. 223611Species Listeria monocytogenes [TaxId:1639] [69173] (2 PDB entries)
  8. 223613Domain d1m9sa1: 1m9s A:241-319 [78874]
    Other proteins in same PDB: d1m9sa2, d1m9sa3, d1m9sa4, d1m9sa5
    complexed with so4, tb

Details for d1m9sa1

PDB Entry: 1m9s (more details), 2.65 Å

PDB Description: Crystal structure of Internalin B (InlB), a Listeria monocytogenes virulence protein containing SH3-like domains.

SCOP Domain Sequences for d1m9sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9sa1 b.1.18.15 (A:241-319) Internalin B {Listeria monocytogenes}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqpl

SCOP Domain Coordinates for d1m9sa1:

Click to download the PDB-style file with coordinates for d1m9sa1.
(The format of our PDB-style files is described here.)

Timeline for d1m9sa1: