Lineage for d1m7lc1 (1m7l C:81-118)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2643822Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 2643823Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 2643895Protein Surfactant protein [57949] (3 species)
  7. 2643896Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)
  8. 2643977Domain d1m7lc1: 1m7l C:81-118 [78737]
    Other proteins in same PDB: d1m7la2, d1m7lb2, d1m7lc2

Details for d1m7lc1

PDB Entry: 1m7l (more details)

PDB Description: solution structure of the coiled-coil trimerization domain from lung surfactant protein d
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d1m7lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7lc1 h.1.1.1 (C:81-118) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpng

SCOPe Domain Coordinates for d1m7lc1:

Click to download the PDB-style file with coordinates for d1m7lc1.
(The format of our PDB-style files is described here.)

Timeline for d1m7lc1: