SCOPe 2.07: Domain d1m7lb1: 1m7l B:41-78

Lineage for d1m7lb1 (1m7l B:41-78)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (3 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)

8. Domain d1m7lb1: 1m7l B:41-78 [78736]
   Other proteins in same PDB: d1m7la2, d1m7lb2, d1m7lc2

Details for d1m7lb1

PDB Entry: 1m7l

PDB Description: solution structure of the coiled-coil trimerization domain from lung surfactant protein d

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d1m7lb1:

Sequence; same for both SEQRES and ATOM records:

>d1m7lb1 h.1.1.1 (B:41-78) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpng

Timeline for d1m7lb1:

• d1m7lb1 first appeared in SCOP 1.63, called d1m7lb_
  
• d1m7lb1 appears in SCOPe 2.06
  
• d1m7lb1 appears in the current release, SCOPe 2.08