| Class h: Coiled coil proteins [57942] (6 folds) |
| Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
| Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
| Protein Surfactant protein [57949] (1 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (2 PDB entries) |
| Domain d1m7lb_: 1m7l B: [78736] |
PDB Entry: 1m7l (more details)
SCOP Domain Sequences for d1m7lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m7lb_ h.1.1.1 (B:) Surfactant protein {Human (Homo sapiens), SP-D}
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi
Timeline for d1m7lb_: