PDB entry 1m7l

View 1m7l on RCSB PDB site
Description: solution structure of the coiled-coil trimerization domain from lung surfactant protein d
Deposited on 2002-07-22, released 2002-11-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-27, with a file datestamp of 2002-11-27.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1m7la_
  • Chain 'B':
    Domains in SCOP 1.63: d1m7lb_
  • Chain 'C':
    Domains in SCOP 1.63: d1m7lc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m7lA (A:)
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m7lB (B:)
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m7lC (C:)
glpdvaslrqqvealqgqvqhlqaafsqykkvelfpnggi