Class b: All beta proteins [48724] (176 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.6: D-aminoacylase [82230] (1 protein) |
Protein N-acyl-D-aminoacid amidohydrolase [82231] (1 species) |
Species Alcaligenes faecalis [TaxId:511] [82232] (8 PDB entries) |
Domain d1m7ja1: 1m7j A:7-61 [78732] Other proteins in same PDB: d1m7ja3 complexed with act, zn |
PDB Entry: 1m7j (more details), 1.5 Å
SCOPe Domain Sequences for d1m7ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m7ja1 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis [TaxId: 511]} pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvsp
Timeline for d1m7ja1: