Lineage for d1m7ja1 (1m7j A:7-61)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 235294Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 235295Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (6 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 235375Family b.92.1.6: D-aminoacylase [82230] (1 protein)
  6. 235376Protein N-acyl-D-aminoacid amidohydrolase [82231] (1 species)
  7. 235377Species Alcaligenes faecalis [TaxId:511] [82232] (1 PDB entry)
  8. 235378Domain d1m7ja1: 1m7j A:7-61 [78732]
    Other proteins in same PDB: d1m7ja3

Details for d1m7ja1

PDB Entry: 1m7j (more details), 1.5 Å

PDB Description: crystal structure of d-aminoacylase defines a novel subset of amidohydrolases

SCOP Domain Sequences for d1m7ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ja1 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis}
pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvsp

SCOP Domain Coordinates for d1m7ja1:

Click to download the PDB-style file with coordinates for d1m7ja1.
(The format of our PDB-style files is described here.)

Timeline for d1m7ja1: