SCOPe 2.02: Domain d1m74a1: 1m74 A:227-348

Lineage for d1m74a1 (1m74 A:227-348)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily)
   core: 4 helices: bundle; flanked by two short beta-hairpins
   duplication: consists of two structural repeats

4. Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family)

5. Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein)

6. Protein Pre-protein crosslinking domain of SecA [81769] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [81770] (4 PDB entries)
   Uniprot P28366

8. Domain d1m74a1: 1m74 A:227-348 [78720]
   Other proteins in same PDB: d1m74a2, d1m74a3, d1m74a4
   complexed with adp, mg, so4

Details for d1m74a1

PDB Entry: 1m74, 3 Å

PDB Description: Crystal structure of Mg-ADP-bound SecA from Bacillus subtilis

PDB Compounds: (A:) Preprotein translocase secA

SCOPe Domain Sequences for d1m74a1:

Sequence; same for both SEQRES and ATOM records:

>d1m74a1 a.162.1.1 (A:227-348) Pre-protein crosslinking domain of SecA {Bacillus subtilis [TaxId: 1423]}
aakstklyvqanafvrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhval
nhhinqalkahvamqkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiq
ne

Timeline for d1m74a1:

• d1m74a1 first appeared in SCOP 1.63
  
• d1m74a1 appears in SCOPe 2.01
  
• d1m74a1 appears in SCOPe 2.03
  
• d1m74a1 appears in the current release, SCOPe 2.08