Class a: All alpha proteins [46456] (284 folds) |
Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily) core: 4 helices: bundle; flanked by two short beta-hairpins duplication: consists of two structural repeats |
Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) automatically mapped to Pfam PF01043 |
Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein) |
Protein Pre-protein crosslinking domain of SecA [81769] (2 species) |
Species Bacillus subtilis [TaxId:1423] [81770] (4 PDB entries) Uniprot P28366 |
Domain d1m74a1: 1m74 A:227-348 [78720] Other proteins in same PDB: d1m74a2, d1m74a3, d1m74a4 complexed with adp, mg, so4 |
PDB Entry: 1m74 (more details), 3 Å
SCOPe Domain Sequences for d1m74a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m74a1 a.162.1.1 (A:227-348) Pre-protein crosslinking domain of SecA {Bacillus subtilis [TaxId: 1423]} aakstklyvqanafvrtlkaekdytydiktkavqlteegmtkaekafgidnlfdvkhval nhhinqalkahvamqkdvdyvvedgqvvivdsftgrlmkgrryseglhqaieakegleiq ne
Timeline for d1m74a1: