SCOPe 2.07: Domain d1m6jb_: 1m6j B:

Lineage for d1m6jb_ (1m6j B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (21 species)

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [82236] (1 PDB entry)

8. Domain d1m6jb_: 1m6j B: [78694]

Details for d1m6jb_

PDB Entry: 1m6j, 1.5 Å

PDB Description: crystal structure of triosephosphate isomerase from entamoeba histolytica

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1m6jb_:

Sequence; same for both SEQRES and ATOM records:

>d1m6jb_ c.1.1.1 (B:) Triosephosphate isomerase {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
gagkfvvggnwkcngtlasietltkgvaasvdaelakkvevivgvpfiyipkvqqilage
anganilvsaenawtksgaytgevhvgmlvdcqvpyvilghserrqifhesneqvaekvk
vaidaglkviacigeteaqrianqteevvaaqlkainnaiskeawkniilayepvwaigt
gktatpdqaqevhqyirkwmteniskevaeatriqyggsvnpancnelakkadidgflvg
gasldaakfktiinsvsekl

Timeline for d1m6jb_:

• d1m6jb_ first appeared in SCOP 1.63
  
• d1m6jb_ appears in SCOPe 2.06
  
• d1m6jb_ appears in the current release, SCOPe 2.08