SCOPe 2.05: Domain d1m64a1: 1m64 A:1-102

Lineage for d1m64a1 (1m64 A:1-102)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)

7. Species Shewanella frigidimarina [TaxId:56812] [48722] (16 PDB entries)

8. Domain d1m64a1: 1m64 A:1-102 [78683]
   Other proteins in same PDB: d1m64a2, d1m64a3, d1m64b2, d1m64b3
   complexed with fad, fum, hem, na; mutant

Details for d1m64a1

PDB Entry: 1m64, 1.8 Å

PDB Description: crystal structure of q363f mutant flavocytochrome c3

PDB Compounds: (A:) flavocytochrome c3

SCOPe Domain Sequences for d1m64a1:

Sequence; same for both SEQRES and ATOM records:

>d1m64a1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina [TaxId: 56812]}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

Timeline for d1m64a1:

• d1m64a1 first appeared in SCOP 1.63
  
• d1m64a1 appears in SCOPe 2.04
  
• d1m64a1 appears in SCOPe 2.06
  
• d1m64a1 appears in the current release, SCOPe 2.08