Lineage for d1m64a2 (1m64 A:103-359,A:506-568)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1833063Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 1833070Protein Flavocytochrome c3 (respiratory fumarate reductase) [51940] (2 species)
    contains additional N-terminal multiheme domain
  7. 1833071Species Shewanella frigidimarina [TaxId:56812] [51941] (16 PDB entries)
  8. 1833076Domain d1m64a2: 1m64 A:103-359,A:506-568 [78684]
    Other proteins in same PDB: d1m64a1, d1m64a3, d1m64b1, d1m64b3
    complexed with fad, fum, hem, na; mutant

Details for d1m64a2

PDB Entry: 1m64 (more details), 1.8 Å

PDB Description: crystal structure of q363f mutant flavocytochrome c3
PDB Compounds: (A:) flavocytochrome c3

SCOPe Domain Sequences for d1m64a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m64a2 c.3.1.4 (A:103-359,A:506-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
ptiaelakdkserqaalasaphdtvdvvvvgsggagfsaaisatdsgakviliekepvig
gnaklaaggmnaawtdqqkakkitdspelmfedtmkggqnindpalvkvlsshskdsvdw
mtamgadltdvgmmggasvnrahrptggagvgahvvqvlydnavkrnidlrmntrgievl
kddkgtvkgilvkgmykgyywvkadavilatggfaknnervakldpslkgfistnqpgav
gdgldvaenaggalkdmXtmggvmidtkaevmnakkqvipglygagevtggvhganrlgg
naisdiitfgrlageeaakys

SCOPe Domain Coordinates for d1m64a2:

Click to download the PDB-style file with coordinates for d1m64a2.
(The format of our PDB-style files is described here.)

Timeline for d1m64a2: